Protein coding transcript 244834

• Transcript: Ll_transcript_79909
• CDS coordinates: 650-1009 (+)
• Peptide sequence: MSSETKGDRKATLDAASWFFNVVTSVGIILVNKALMATYGFTFATTLTGMHFATTTLLTTILKSLGYIQSSHIPLHDIIKFVLFANFSIVGMNVSLMWNSVGFYQVYSGLFSHFLKKQT*
• ORF Type: complete

Annotations of Ll_transcript_79909

• Blastp: UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 76.42% of identity
• Blastx: UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 64.93% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434998.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;