Protein coding transcript 244847

• Transcript: Ll_transcript_79906
• CDS coordinates: 1837-2517 (+)
• Peptide sequence: MIPVSCFLEVVLDNVRYSRDTKLSITLVLLGVAVCTVTDVSVNTRGFIAAAIAVWSTALQQYYVHFLQRKYSVGSFNLLGHTAPAQAASLLLVGPFMDYWLTNKRVDAYNYGLTSILFIIMSCTIAVGTNLSQFICIGRFTAVTFQVLGHMKTILVLILGFIFFGKDGLNLQVVLGMFIAILGMVWYGNASSKPGGKEHRNFSIPATTKAPDYSAVPVSTEPDEKV*
• ORF Type: complete

Annotations of Ll_transcript_79906

• Blastp: UDP-rhamnose/UDP-galactose transporter 4 from Arabidopsis with 80.53% of identity
• Blastx: UDP-rhamnose/UDP-galactose transporter 4 from Arabidopsis with 67.04% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430220.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;