Transcript | Ll_transcript_79769 |
---|---|
CDS coordinates | 947-1333 (+) |
Peptide sequence | MCNPPFFESLEEAGLNPKTSCGGTSKEMVCPGGEKAFITRIIEDSTELKHQFRWFTSMIGRKTNLKYLTSKLWEVGVTIVKTTEFVQGRTSRWGLAWSFLPPIQKSSISLPEKKSNISFLVEGSSREG* |
ORF Type | complete |
Blastp | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase from Gallus with 41.13% of identity |
---|---|
Blastx | U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase from Danio with 34.96% of identity |
Eggnog | Specifically methylates the adenine in position 1618 of 23S rRNA (By similarity)(COG3129) |
Kegg | Link to kegg annotations (431184) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460068.1) |
Pfam | Protein of unknown function (DUF890) (PF05971.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer