| Transcript | Ll_transcript_79774 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | TPLSQLINNNNNNAQYSLHLHPLITNFSTHNQQLLVVNEHSTATNVNGHREVAGKVEEQLAAARTSIRTNRSAANEGGDEGYVPSRAVYWNPRLFYRSYLEMRKY* |
| ORF Type | 5prime_partial |
| Blastp | Probable glycosyltransferase At3g07620 from Arabidopsis with 42.86% of identity |
|---|---|
| Blastx | Probable glycosyltransferase At3g07620 from Arabidopsis with 42.86% of identity |
| Eggnog | Exostosin(ENOG410XTFH) |
| Kegg | Link to kegg annotations (AT3G07620) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019457420.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer