Protein coding transcript 244864

• Transcript: Ll_transcript_79776
• CDS coordinates: 480-839 (+)
• Peptide sequence: MEKILKVYVYRDGDHPIAHDGPCKDIYSIEGRFLHEIEHGHGRFRTNDPNLAHVYFLPFSVAWMVKYLYTPLSYDHSPLRQFVSDYVRLISTKYPFWNSTHGADHFMLACHDWDLPSQHG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_79776

• Blastp: Probable glycosyltransferase At5g25310 from Arabidopsis with 63.72% of identity
• Blastx: Probable glycosyltransferase At5g25310 from Arabidopsis with 54.01% of identity
• Eggnog: Exostosin(ENOG410XTFH)
• Kegg: Link to kegg annotations (AT5G25310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457420.1)
• Pfam: Exostosin family (PF03016.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;