Protein coding transcript 244883

• Transcript: Ll_transcript_80701
• CDS coordinates: 122-1345 (+)
• Peptide sequence: MGTFSSPFPFLLLLLLCFPSFSFGATLVQDEVLYIYIYIFIYIISVEALKDIGKTLGKKDWDFSLDPCSGKNNWKSVNQSKGSENSVTCNCSFANNTACHVISIVLKSQNLSGTLPPELVRLPYLQEIDLTRNYLDGTIPTQWGTLNLVNMVLECNQFYGNLPPELGNLTQIERLLLTSNNFSGEIPATFAKLTTLKHVRVGDNQFSGAIPSFIQSWINLEILVIQGSGFSGPIPSGISLLKNLTDLRITDLNGSDSPFPQLNMTNLETLILRSCNITGALPEHLGNLISLQRLDLSYNKLSGPIPSSFGGLQNMNMLYLAGNNLTGSLPQWIAKPDFVDLSYNNFNIGSLEQQTCQQGSANLFSSSSNGNSLGNVSCLANVQCPKTLYYSLYINCGGKLTTSNGSKS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_80701

• Blastp: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 49.18% of identity
• Blastx: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 50.38% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449222.1)
• Pfam: Leucine rich repeat (PF13855.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;