Transcript | Ll_transcript_80708 |
---|---|
CDS coordinates | 355-951 (+) |
Peptide sequence | MVLECNQFYGNLPPELGNLTQIERLLLTSNNFSGEIPATFAKLTTLKHVRVGDNQFSGAIPSFIQSWINLEILVIQGSGFSGPIPSGISLLKNLTDLRITDLNGSDSPFPQLNMTNLETLILRSCNITGALPEHLGNLISLQRLDLSYNKLSGPIPSSFGGLQNMNMLYLAGNNLTGSLPQWIAKPDFVDLSYNNFNIG |
ORF Type | 3prime_partial |
Blastp | Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 59.8% of identity |
---|---|
Blastx | Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 54.65% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT3G14840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449222.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer