Protein coding transcript 244895

• Transcript: Ll_transcript_80716
• CDS coordinates: 355-792 (+)
• Peptide sequence: MVLECNQFYGNLPPELGNLTQIERLLLTSNNFSGEIPATFAKLTTLKHVRVGDNQFSGAIPSFIQSWINLEILVIQGSGFSGPIPSGISLLKNLTDLRITDLSGSDSPFPQLDDMINLTTLILRSCNITGALPEYLGNLISLKQL*
• ORF Type: complete

Annotations of Ll_transcript_80716

• Blastp: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 65.52% of identity
• Blastx: Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840 from Arabidopsis with 57.28% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT3G14840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449223.1)
• Pfam: Leucine Rich Repeat (PF00560.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;