| Transcript | Ll_transcript_79339 |
|---|---|
| CDS coordinates | 629-1123 (+) |
| Peptide sequence | MSQFNGDVQGTSHTAGCSKEISEDILTPANAIRAESKQIASPHINVEEKGPRGEEENISAKTLGDNGTSPNKELSEPVVESAAVSTQLKENDNPDYGSSHDIDLTKTPQQKPKRRRKHRPKVIIEGKPKRTRKPATQKPAQAKETPTVKRKYVQKKPQLSRGSMF |
| ORF Type | 3prime_partial |
| Blastp | Transcriptional activator DEMETER from Arabidopsis with 37% of identity |
|---|---|
| Blastx | - |
| Eggnog | endonuclease III(COG0177) |
| Kegg | Link to kegg annotations (AT5G04560) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019453314.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer