Transcript | Ll_transcript_80864 |
---|---|
CDS coordinates | 66-563 (+) |
Peptide sequence | MFLRAVARPLMARVKQTTGIVGLDVVPNAREVLIGLYSKTLNEIKAVPEDEGYRKAVESFTSHRLKVCQEEEDWEDIEKKLGCGQVEELIEEAQDELKLISLMNEWKPWGVPDDYECEVIENDAPVPKHVPLHRPPPLPTEFHKTLESLQSGKDTAAISSGESKA* |
ORF Type | complete |
Blastp | Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial from Arabidopsis with 81.88% of identity |
---|---|
Blastx | Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial from Arabidopsis with 79.35% of identity |
Eggnog | NADH dehydrogenase (Ubiquinone) 1 alpha subcomplex(ENOG4111V89) |
Kegg | Link to kegg annotations (AT5G52840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453867.1) |
Pfam | ETC complex I subunit conserved region (PF04716.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer