Protein coding transcript 244969

• Transcript: Ll_transcript_80878
• CDS coordinates: 1797-2225 (+)
• Peptide sequence: MAIDKFGTAAVRNAWYDPKLVSEHVLSGYTRPLRTSDWDKALLEYTAALLLDEESKTKPSLSQRLHEISCPVLIVTGDTDRIVPSWNAERLSRAIPGASFHVIKQCGHLPHEEKVDEFISIVENFLGRLVGDSTEQHLQSVM*
• ORF Type: complete

Annotations of Ll_transcript_80878

• Blastp: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase from Klebsiella with 42.31% of identity
• Blastx: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase from Klebsiella with 42.31% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (KPN_02120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417082.1)
• Pfam: Alpha/beta hydrolase family (PF12697.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;