Transcript | Ll_transcript_80878 |
---|---|
CDS coordinates | 1797-2225 (+) |
Peptide sequence | MAIDKFGTAAVRNAWYDPKLVSEHVLSGYTRPLRTSDWDKALLEYTAALLLDEESKTKPSLSQRLHEISCPVLIVTGDTDRIVPSWNAERLSRAIPGASFHVIKQCGHLPHEEKVDEFISIVENFLGRLVGDSTEQHLQSVM* |
ORF Type | complete |
Blastp | 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase from Klebsiella with 42.31% of identity |
---|---|
Blastx | 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase from Klebsiella with 42.31% of identity |
Eggnog | Alpha beta hydrolase(COG0596) |
Kegg | Link to kegg annotations (KPN_02120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417082.1) |
Pfam | Alpha/beta hydrolase family (PF12697.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer