Transcript | Ll_transcript_290420 |
---|---|
CDS coordinates | 385-879 (+) |
Peptide sequence | MAKFTPEEVASLEAGGNERAKQIYFKEWDSQRHSYPDSNNMHRLRDFIKHVYVDRKFTGERGAVVLPRLKLKDKEDHYENKKVSSFRLESKSSPQYEDRIERYNSDRSSPGIRSDDKNLRFYYDETRSPKYAQRCAKPGTFGRSPIKFEVVDDRFRDDESRNRRL |
ORF Type | 3prime_partial |
Blastp | Probable ADP-ribosylation factor GTPase-activating protein AGD14 from Arabidopsis with 41.51% of identity |
---|---|
Blastx | Probable ADP-ribosylation factor GTPase-activating protein AGD14 from Arabidopsis with 51.7% of identity |
Eggnog | ArfGAP with FG repeats(ENOG41122WA) |
Kegg | Link to kegg annotations (AT1G08680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416197.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer