Protein coding transcript 245164

• Transcript: Ll_transcript_79703
• CDS coordinates: 739-1128 (+)
• Peptide sequence: MHGHMKTMGMDAFRVSLSSAVSSSSQGSGHDDGDALGDVFIWGEGTGDDGVLGGGTHRVGSCLGVKMDSLFPKALESAVVLDVQNIACGGQHAALVTKQGEFFSWGEESGGRLGHGVESDVLLPKLIESL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_79703

• Blastp: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 60.8% of identity
• Blastx: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 45.96% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (AT1G76950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461104.1)
• Pfam: Regulator of chromosome condensation (RCC1) repeat (PF00415.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;