Protein coding transcript 245168

• Transcript: Ll_transcript_79689
• CDS coordinates: 696-1733 (+)
• Peptide sequence: MDESVLIWFSGKEEKHLKLSHVSRIISGQRTPIFQRYPRPEKEYQSFSLIYNDRSLDLICKDKDEAEVWFSGLKALVSRSHHQKWRTESRSDGVPSEASSPRTYTRSCSPLNSPFGSSDSLQKDSGDHLHSPYESPPKNGSDKAFSDVVLYAIPPKGFFPPASASGPVHSVSPGGSEIMHGHIKTMGMDAFRVSLSSAFSSSSQGSGHDDGDAFGDVFIWGEGTGDGVLGGGTHRVGSCLGVKMDSLFPKALEAAVVLDVQNIACGGQHAALVTKQGEIFSWGEESGGRLGHGVETDILHPKLIESLSNTNIELVACGEYHTCAVTFSGDLYTWGDGTYNYGLLGH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_79689

• Blastp: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 55% of identity
• Blastx: PH, RCC1 and FYVE domains-containing protein 1 from Arabidopsis with 48.15% of identity
• Eggnog: regulator of chromosome condensation(COG5184)
• Kegg: Link to kegg annotations (AT1G76950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434800.1)
• Pfam: Pleckstrin homology domain (PF16457.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;