Protein coding transcript 245308

• Transcript: Ll_transcript_81350
• CDS coordinates: 602-1078 (+)
• Peptide sequence: MKQWQAVIFPLSLTSLMYAGYLFHKSLLLLDSWREHRSSGGSLSFASCKYFSQCFLAWLSAISSNVLVWRNYVVAPITEELVFRAGMIPLLLCGGFRPYSVILLCPIFFSLAHLNHFMEIYAKQNYRIKKAVMIIGLQLGYTVIFGSYASFLFIRTGM*
• ORF Type: complete

Annotations of Ll_transcript_81350

• Blastp: CAAX prenyl protease 2 from Arabidopsis with 59.74% of identity
• Blastx: CAAX prenyl protease 2 from Arabidopsis with 59.74% of identity
• Eggnog: RCE1 homolog, prenyl protein protease (S. cerevisiae)(ENOG410YPVA)
• Kegg: Link to kegg annotations (AT2G36305)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431497.1)
• Pfam: CAAX protease self-immunity (PF02517.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;