Protein coding transcript 245309

• Transcript: Ll_transcript_81353
• CDS coordinates: 228-605 (+)
• Peptide sequence: MSLSPTSSIGLLLQQPLTMEQDGVVSKPIAVIASISMALLYVAVLYAPTLLLRLPPPSSFTNYMIRRFLCAVVSSIISLLISALILPVQTKELFGVYGIRVDHIIGKQTRSLSFLNFIAEIRFSV*
• ORF Type: complete

Annotations of Ll_transcript_81353

• Blastp: CAAX prenyl protease 2 from Arabidopsis with 48.89% of identity
• Blastx: CAAX prenyl protease 2 from Arabidopsis with 55.05% of identity
• Eggnog: RCE1 homolog, prenyl protein protease (S. cerevisiae)(ENOG410YPVA)
• Kegg: Link to kegg annotations (AT2G36305)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431497.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;