Transcript | Ll_transcript_81345 |
---|---|
CDS coordinates | 792-1496 (+) |
Peptide sequence | MKQWQAVIFPLSLTSLMYAGYLFHKSLLLLDSWREHRSSGGSLSFASCKYFSQCFLAWLSAISSNVLVWRNYVVAPITEELVFRAGMIPLLLCGGFRPYSVILLCPIFFSLAHLNHFMEIYAKQNYRIKKAVMIIGLQLGYTVIFGSYASFLFIRTGHLISPLVAHIFCNFMGLPVLFSRRNGIVCIAFIMGFLGFLWLLFPMTEPHLYNDTIDNCSYWQGHCSWSQGIERSSM* |
ORF Type | complete |
Blastp | CAAX prenyl protease 2 from Arabidopsis with 57.85% of identity |
---|---|
Blastx | CAAX prenyl protease 2 from Arabidopsis with 57.85% of identity |
Eggnog | RCE1 homolog, prenyl protein protease (S. cerevisiae)(ENOG410YPVA) |
Kegg | Link to kegg annotations (AT2G36305) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431497.1) |
Pfam | CAAX protease self-immunity (PF02517.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer