| Transcript | Ll_transcript_290451 |
|---|---|
| CDS coordinates | 165-578 (+) |
| Peptide sequence | MSKVTLSLVCLFLSTLFNNFSCADVGTAAQYGPPFIPTKCFGGDASEFPSSNMFGAAGEGIWDNGAACGRKYKVRCLSAVVPKACVPGQNIQITIVDRAQSSISRPSSERATMVLSTNAFQAIANASVSLINIEYQE* |
| ORF Type | complete |
| Blastp | EG45-like domain containing protein from Citrus with 32.85% of identity |
|---|---|
| Blastx | EG45-like domain containing protein from Citrus with 32.85% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019436084.1) |
| Pfam | Lytic transglycolase (PF03330.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer