Protein coding transcript 245445

• Transcript: Ll_transcript_118934
• CDS coordinates: 1007-1339 (+)
• Peptide sequence: MTLAIMDAQKVVEEKQRRINDTHRALQLLKTTSVVWPNTASEVLLVGSFDGWSTQRKMDKSSTGIFSVCLQLYPGKYEIKFIVDGEWKIDPLLPIVDNNGHVNNLLVVHD*
• ORF Type: complete

Annotations of Ll_transcript_118934

• Blastp: Protein PTST, chloroplastic from Arabidopsis with 42.17% of identity
• Blastx: Protein PTST, chloroplastic from Arabidopsis with 44.12% of identity
• Eggnog: Protein kinase, AMP-activated, beta(ENOG410XRB3)
• Kegg: Link to kegg annotations (AT5G39790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462070.1)
• Pfam: Carbohydrate-binding module 48 (Isoamylase N-terminal domain) (PF02922.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;