Protein coding transcript 245462

• Transcript: Ll_transcript_120561
• CDS coordinates: 511-912 (+)
• Peptide sequence: MNLPFSEHCVISKQHRLKFNRSTARSKHILDLIHSNVWESPEISLRGSRYFVSFIDDYARRLWMYPIKKKSDVFPVFKEFKAQVELETGKIIKCLRTDNGGEYIDSNFISFCRQKGIQRKFTVAHTPQQNGVA*
• ORF Type: complete

Annotations of Ll_transcript_120561

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 50% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 47.69% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963654.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;