Protein coding transcript 245490

• Transcript: Ll_transcript_120613
• CDS coordinates: 664-1023 (+)
• Peptide sequence: MGGAATVVCLQQLKSILGLEHFTHAADIVSVMRSVFTQTHEWRWESAVLGVCFIFFLLLTRFFSKRQPKLFWVSAMAPLTSVILGSVLVYFTHAEKHGVQVIGELKKGLNPTSITDLVFV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_120613

• Blastp: Sulfate transporter 3.1 from Arabidopsis with 76.47% of identity
• Blastx: Sulfate transporter 3.1 from Arabidopsis with 79.41% of identity
• Eggnog: sulfate transporter(COG0659)
• Kegg: Link to kegg annotations (AT3G51895)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428619.1)
• Pfam: Sulfate permease family (PF00916.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;