Protein coding transcript 245496

• Transcript: Ll_transcript_120621
• CDS coordinates: 1-309 (+)
• Peptide sequence: VQPWLIGLMMQVALSLLRILLFIGRPRTFVLGNIPNSVIYRNVEQYPNANHVPGILILKIDAPIYFANAIYLRERWIDEEEDGIKATWETSLQYVIMDMTGK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_120621

• Blastp: Sulfate transporter 3.1 from Arabidopsis with 65.66% of identity
• Blastx: Sulfate transporter 3.1 from Arabidopsis with 65.66% of identity
• Eggnog: sulfate transporter(COG0659)
• Kegg: Link to kegg annotations (AT3G51895)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427380.1)
• Pfam: STAS domain (PF01740.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;