Transcript | Ll_transcript_120603 |
---|---|
CDS coordinates | 3-422 (+) |
Peptide sequence | PLVVLSAIIVSAMLGLIDYEAAIHLWKIDKFDFVVCISAYIGVVFGSVEIGLVIAVALSLLRILLFIARPRTFVLGNIPNSVIYRNVGQYPNANHVPGILILKIDAPIYFTNAIYLKERWIDEEEDRIKATGKRVCNIL* |
ORF Type | 5prime_partial |
Blastp | Sulfate transporter 3.1 from Arabidopsis with 74.26% of identity |
---|---|
Blastx | Sulfate transporter 3.1 from Arabidopsis with 74.26% of identity |
Eggnog | sulfate transporter(COG0659) |
Kegg | Link to kegg annotations (AT3G51895) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427380.1) |
Pfam | Sulfate permease family (PF00916.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer