Protein coding transcript 245576

• Transcript: Ll_transcript_120381
• CDS coordinates: 64-381 (+)
• Peptide sequence: MFFRFIYVFIGIGVVLFVISCFGCIGAVTRSGCCLSFYSVLVVLLILAELGCAAFIFFDKSWKEEIPADKTGAFDMIYGFLRENWNLVKWVALGIVIFEALLFFLA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_120381

• Blastp: Tobamovirus multiplication protein 2A from Arabidopsis with 69.89% of identity
• Blastx: Tobamovirus multiplication protein 2A from Arabidopsis with 66.67% of identity
• Eggnog: Tetraspanin family(ENOG4111KWC)
• Kegg: Link to kegg annotations (AT1G32400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424264.1)
• Pfam: Tetraspanin family (PF00335.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;