Transcript | Ll_transcript_120387 |
---|---|
CDS coordinates | 196-765 (+) |
Peptide sequence | MACCCKGFWECLLKLLNFILTLTGLAMVGYGIYLLVEFTKASGDTPAFPPVSDDRDLIRLGRPMLMAVSLSDSFLDKLPKAWFIYVFIGIGVVLFVISCFGCIGAVTRSGCCLSFYSVLVVLLILAELGCAAFIFFDKSWKEEIPADKTGAFDMIYGFLRENWNLVKWVALGIVIFEVSNKWYDCHLRK* |
ORF Type | complete |
Blastp | Tobamovirus multiplication protein 2A from Arabidopsis with 61.99% of identity |
---|---|
Blastx | Tobamovirus multiplication protein 2A from Arabidopsis with 61.99% of identity |
Eggnog | Tetraspanin family(ENOG4111KWC) |
Kegg | Link to kegg annotations (AT1G32400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424264.1) |
Pfam | Tetraspanin family (PF00335.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer