Protein coding transcript 245584

• Transcript: Ll_transcript_120392
• CDS coordinates: 504-1340 (+)
• Peptide sequence: MACKGFWECLLKLFNFLVTLAGLAMVGYGIYLLVEYKKVSDNTLTIPTDDQTLVQLGRPMLMAVSLSDSIFDDLPKAWFIFIFIGVGAILFVVSCFGCIGALTRNGCCLSFYAVLLVLLILAELGCAAFIFFDKSWKEEIPTDRTGDFDMIYGFLRENWKIVKWVALGIVIFEALLFLLALIVRAANRPADYDSDEEFLNPRQQVRQPLLNRPAAPATGVPVAGTLDQRPSRNDAWSSRMREKYGLDTSEFTYNPSDPHRFQQVNSQPTEEKSGCTIM*
• ORF Type: complete

Annotations of Ll_transcript_120392

• Blastp: Tobamovirus multiplication protein 2A from Arabidopsis with 71.07% of identity
• Blastx: Tobamovirus multiplication protein 2A from Arabidopsis with 71.07% of identity
• Eggnog: Tetraspanin family(ENOG4111KWC)
• Kegg: Link to kegg annotations (AT1G32400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424195.1)
• Pfam: Tetraspanin family (PF00335.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;