Protein coding transcript 245589

• Transcript: Ll_transcript_120372
• CDS coordinates: 988-1377 (+)
• Peptide sequence: MIYGFLKENMNIVKWVALGIVIFEALLFLLALIVRAANRPADYDSDEEFLNPRQQVRQPLLNRPAAPATGVPVAGTLDQRPSRNDAWSSRMREKYGLDTSEFTYNPSDPHRFQQVNSQPTEEKSGCTIM*
• ORF Type: complete

Annotations of Ll_transcript_120372

• Blastp: Tobamovirus multiplication protein 2A from Arabidopsis with 76.56% of identity
• Blastx: Tobamovirus multiplication protein 2A from Arabidopsis with 60.91% of identity
• Eggnog: Tetraspanin family(ENOG4111KWC)
• Kegg: Link to kegg annotations (AT1G32400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433220.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;