Protein coding transcript 245612

• Transcript: Ll_transcript_118473
• CDS coordinates: 3-560 (+)
• Peptide sequence: KLLEPDVVKWPVLLVEKMIHQTCRGFNHAVNGFNDDGWSVLNCDGAEDVIISVNSTKNLSGTSNLATPLTSLGGVLCAKASMLLQNVPPAALIRFLREHRSEWADFNVDAYSAASLKDGSNAYPGMRPTSFTGNQIIMPLGHTIEHEEMLEVVRLEGHSLAQEDAFVSRDIHLLQICSGIDENSVG
• ORF Type: internal

Annotations of Ll_transcript_118473

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 82.21% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 82.21% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: Link to cantataDB annotations (CNT0000180)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447870.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;