Transcript | Ll_transcript_118480 |
---|---|
CDS coordinates | 101-412 (+) |
Peptide sequence | MLEVIRLEGHSLAQEDAFASRDIHLLQICSGVDENSAGLCSELIFAPINEMFPDDAPLVPSGFRIIPLDSKPGGKNDVTTANETLDLTSGLEVSPSTNNADGDA |
ORF Type | 3prime_partial |
Blastp | Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 77.23% of identity |
---|---|
Blastx | Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 76.47% of identity |
Eggnog | Homeobox-leucine zipper protein(ENOG410ZJBV) |
Kegg | Link to kegg annotations (AT5G60690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458095.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer