Protein coding transcript 245619

• Transcript: Ll_transcript_118455
• CDS coordinates: 105-809 (+)
• Peptide sequence: MIHYTCRGFNNAVNGFNDDGWSVLNCGAVEDVIITVNSTKNSIDTSNPASSLTFFGGILCAKASMLLQNVPPSVLIRFLREHRSEWADFNVDAYSAASLKAGSYASPEMRPIKFTGNQIIMPLGHTIEHEEMLEVIRLEGHSLAQEDAFASRDIHLLQICSGVDENSAGLCSELIFAPINEMFPDDAPLVPSGFRIIPLDSKPGGKNDVTTANETLDLTSGLEVSPSTNNADGDA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_118455

• Blastp: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 76.11% of identity
• Blastx: Homeobox-leucine zipper protein REVOLUTA from Arabidopsis with 76.11% of identity
• Eggnog: Homeobox-leucine zipper protein(ENOG410ZJBV)
• Kegg: Link to kegg annotations (AT5G60690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458095.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;