Protein coding transcript 245744

• Transcript: Ll_transcript_120945
• CDS coordinates: 402-719 (+)
• Peptide sequence: MWDQKTSRSRGFGFVSFRNQQEAQSAINNLTGKWLGSRQIRCNWATKGANVNDEKHSLDSKTVVELANGTSEGKELTNDDAPEKNLQYTTVYVGNLAPEARISIL*
• ORF Type: complete

Annotations of Ll_transcript_120945

• Blastp: Oligouridylate-binding protein 1A from Arabidopsis with 74% of identity
• Blastx: Oligouridylate-binding protein 1B from Arabidopsis with 58.57% of identity
• Eggnog: TIA1 cytotoxic granule-associated RNA binding(ENOG410XQ8U)
• Kegg: Link to kegg annotations (AT1G54080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443470.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;