Protein coding transcript 245776

• Transcript: Ll_transcript_120406
• CDS coordinates: 1330-2019 (+)
• Peptide sequence: MVPYSGWAPYQATATSTVLPSSTPSNVGSAQLYGITQLPSLAGAYTGPYQPSGSVIGPSSSSQKEHSLPERPDQPECQYYMRTGECKFGPSCRYNHPPDMSAPKATVTLSPAGLPLRPGAPPCTHYAQRGVCKFGPACRFDHPVAPLSYSPSASSLADMPVAPYPVGSSIGTLAPSSSSSELQPDLTPGSNKEAISSRLSLPMSTTTGSVGLTLSTGGSVSQSSSQPSS*
• ORF Type: complete

Annotations of Ll_transcript_120406

• Blastp: Zinc finger CCCH domain-containing protein 6 from Oryza sativa with 48.79% of identity
• Blastx: Zinc finger CCCH domain-containing protein 58 from Arabidopsis with 56.57% of identity
• Eggnog: zinc finger, CCCH(ENOG410Y25U)
• Kegg: Link to kegg annotations (4326236)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439709.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;