Protein coding transcript 245780

• Transcript: Ll_transcript_120412
• CDS coordinates: 258-1229 (+)
• Peptide sequence: MESFARSTEGSRSDPSLEWTGHGGETGLQGSMWQLGLGGGGGGEESYPLRPGEADCMYYLRTGVCGYGLHCRFNHPPDRGAVIGAAKTGEFPERVGQPVCQYYMRTGSCKFGPSCKYHHPKEGGGTANPVSLNYYGYPLRPGEKECSYYVKTGQCKFGSTCKFHHPQPAGVQIAPPPRPVPQVSHLSVPVPSPLYQTVQPPSDPLSQQLSVLVARPPLLPGSYVQSPYGPVVLSPAMVPYSGWAPYQATATSPILPSSTPSNVGSAQLYGITQLASPAGAYPGPYQPSGSKIGPSSSSQKEHSLPERPDQPECQHYLRTGECKF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_120412

• Blastp: Zinc finger CCCH domain-containing protein 58 from Arabidopsis with 58.56% of identity
• Blastx: Zinc finger CCCH domain-containing protein 58 from Arabidopsis with 58.13% of identity
• Eggnog: zinc finger(COG5063)
• Kegg: Link to kegg annotations (AT5G18550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419041.1)
• Pfam: Zinc finger C-x8-C-x5-C-x3-H type (and similar) (PF00642.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;