Transcript | Ll_transcript_120453 |
---|---|
CDS coordinates | 521-1780 (+) |
Peptide sequence | MFALILSFGLLLTALKSRKARSWRYGSGWLRGFIADYGVPLMIIVWTSFSYIPAGSIPKGIPRRLFSPNPWSPGAYESWTVIKDMLDVPIHYIFGAFIPATMIAVLYYFDHSVASQLAQQKEFNLRKPPSFHYDLLLLGFMVILCGLIGVPPSNGVIPQSPMHTKSLATLKHLLLRNRLVATARRCMKNQASLGQVYGSMKEAYWQMQSPLVHQEPSSQGLNELKESTIQLASSMGTINAPVDESIFDVEKEIDDLLPVEVKEQRVSNLLQSLMVGGCVAAMPFLKMIPTSVLWGYFAFMAIENLPGNQFWERILLMFTSPSRRYKVLEECHASYVESVPFKTIAVFTLFQTAYLLVCFGITWVPIAGVLFPLMIMLLVPVRQYILPKFFKGVHLQDLDAAEYEVPALPFDLATVSLKY* |
ORF Type | complete |
Blastp | Boron transporter 1 from Arabidopsis with 80.92% of identity |
---|---|
Blastx | Boron transporter 1 from Arabidopsis with 79.46% of identity |
Eggnog | solute carrier family 4(ENOG410XPHD) |
Kegg | Link to kegg annotations (AT2G47160) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418827.1) |
Pfam | HCO3- transporter family (PF00955.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer