Protein coding transcript 245940

• Transcript: Ll_transcript_119462
• CDS coordinates: 1-654 (+)
• Peptide sequence: PHVVNLTLVDLPGLTKVAVEGQPDSIVQDIENMVRAFIEKPNCIILAISPANQDLATSDAIKISREVDPKGERTFGVLTKIDLMDKGTDAVEILEGRAFKLKFPWIGVVNRSQQDINKNVDMIAARRREREYFATTPEYTHLANRMGSEHLAKMLSKHLETVIKSKIPGIQSLISKTVAELEFELARLGKPAAIDAGGKLYAIMEICRTFDQIFKEHL
• ORF Type: internal

Annotations of Ll_transcript_119462

• Blastp: Dynamin-related protein 5A from Soja with 89.91% of identity
• Blastx: Dynamin-related protein 5A from Soja with 89.91% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (100037461)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422463.1)
• Pfam: Dynamin family (PF00350.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;