Transcript | Ll_transcript_119491 |
---|---|
CDS coordinates | 2-463 (+) |
Peptide sequence | REVDPTGERTIGVLTKIDLMDKGTDAVEILEGRAFKLKFPWIGVVNRSQQDINKNVDMIAARRREREYFASTPEYRHLAHRMGSEHLAKMLSKHLETVIKSKIPGIQSLISKTVAELEFELARLGKPAAIDAGGKLYAIMEICRTFDQIFKEHL |
ORF Type | internal |
Blastp | Dynamin-related protein 5A from Soja with 90.26% of identity |
---|---|
Blastx | Dynamin-related protein 5A from Soja with 90.26% of identity |
Eggnog | Dynamin family(COG0699) |
Kegg | Link to kegg annotations (100037461) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422463.1) |
Pfam | Dynamin central region (PF01031.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer