Transcript | Ll_transcript_120974 |
---|---|
CDS coordinates | 1813-2838 (+) |
Peptide sequence | MPPIEQRNLFSFENPRIRFGEGQLQHLSNSKPMNLLHGIPTNMEPKQLANLHQPNQSIGNLNLRINSSTAQSNPLVMHMAQSQPRGQMINENIGSQVNRLPSSLAHPKLPNGTSNAVLGYGIAGTSIITPTYNPVHQNSSMLTLPMNQSTEMSASSFPLGSTLRISSMATKGMFHEEVSSGIKGSGGFVPSYDIFDELNQHKSHDWGLTNAGLTFDASQHANTLQRTIDVSPSVLVHQSFSSIHQTGQNRDPTSIGKGMFSIGEGTSQRNLQNFGQHLNTHLVDNSVKAERVHDPSSQINLFSEQYGQEDLMIELLKQQGGSGPAENEFDFDGYSLDNIQA* |
ORF Type | complete |
Blastp | Two-component response regulator ARR2 from Arabidopsis with 34.05% of identity |
---|---|
Blastx | Two-component response regulator ARR2 from Arabidopsis with 72.6% of identity |
Eggnog | two component, sigma54 specific, transcriptional regulator, Fis family(COG2204) |
Kegg | Link to kegg annotations (AT4G16110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440184.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer