| Transcript | Ll_transcript_391700 |
|---|---|
| CDS coordinates | 1174-1482 (+) |
| Peptide sequence | MRVEEERIDAEKRRVKEEAQQLAQIFETVGAFKVKRKGGKGKQIFGSVTAQDLVDIIKAQLQREVDKRVVELPEIRETGEYVAELKLHPEVTAKVRVNVFAN* |
| ORF Type | complete |
| Blastp | 50S ribosomal protein L9, chloroplastic from Triticum with 79.21% of identity |
|---|---|
| Blastx | 50S ribosomal protein L9, chloroplastic from Triticum with 78.64% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019449779.1) |
| Pfam | Ribosomal protein L9, C-terminal domain (PF03948.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer