Protein coding transcript 246021

• Transcript: Ll_transcript_120842
• CDS coordinates: 294-839 (+)
• Peptide sequence: MWESIILTVAATAGNNIGKILQKKGTIILPPFSFKLKVIRAYASNKTWLIGFLMDIFGALLMLRALSLAPVSVIQPVSGCGLAILSIFSHFYLKEVMNFVDWVGITLAGFGTIGVGAGGEEQEAVALSIFHIPSLAFVVFILFILLNGWLRIYKRQRREQEMVVIHVLILNTFRFTFLCSL*
• ORF Type: complete

Annotations of Ll_transcript_120842

• Blastp: Probable magnesium transporter NIPA9 from Arabidopsis with 79.63% of identity
• Blastx: Probable magnesium transporter NIPA9 from Arabidopsis with 79.63% of identity
• Eggnog: Pfam:DUF803(ENOG41124JW)
• Kegg: Link to kegg annotations (AT5G11960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437024.1)
• Pfam: Magnesium transporter NIPA (PF05653.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;