Transcript | Ll_transcript_120857 |
---|---|
CDS coordinates | 278-823 (+) |
Peptide sequence | MWESILLTVAATAGNNIGKILQKKGTIILPPLSFKLKIIRTYALNKTWLIGFLMDIFGALLMLRALSLAPVSVIQPVSGCGLAILSIFSHFYLKEVMNIVDWVGITLAGFGTIGVGAGGEEQEAVALSIFHIPSLAFVVFILFILLNGWLRIYKRQRREQEMVVIHVLILNTFRFTFLCSL* |
ORF Type | complete |
Blastp | Probable magnesium transporter NIPA9 from Arabidopsis with 79.01% of identity |
---|---|
Blastx | Probable magnesium transporter NIPA9 from Arabidopsis with 79.01% of identity |
Eggnog | Pfam:DUF803(ENOG41124JW) |
Kegg | Link to kegg annotations (AT5G11960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458271.1) |
Pfam | Magnesium transporter NIPA (PF05653.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer