| Transcript | Ll_transcript_120725 |
|---|---|
| CDS coordinates | 94-393 (+) |
| Peptide sequence | MGNVGISDSEIHNYQIILKENGSPRITSLPSNPKKGAIFSGSEVCLCPSVSLDLLLAEVYSFLQKMLILNIPNVAIQLVAEDCAVPGSQYEKVFLANECT |
| ORF Type | 3prime_partial |
| Blastp | Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 38.71% of identity |
|---|---|
| Blastx | Type 2 DNA topoisomerase 6 subunit B-like from Arabidopsis with 38.71% of identity |
| Eggnog | NA(ENOG410YF05) |
| Kegg | Link to kegg annotations (AT1G60460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445722.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer