| Transcript | Ll_transcript_119101 |
|---|---|
| CDS coordinates | 1-354 (+) |
| Peptide sequence | STTRFGMVTMTDDPLTSGPELESKLVGKAQGIYASAAQDEVGLLMVMNFAFTEGQFNGSTLSVLGRNTVFSAVREISIVGGSGLFRFARGYALAKTHTFDQKTGDAVVEYDVYVFHY* |
| ORF Type | 5prime_partial |
| Blastp | Dirigent protein 22 from Arabidopsis with 62.39% of identity |
|---|---|
| Blastx | Dirigent protein 19 from Arabidopsis with 60.55% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT3G13660) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418342.1) |
| Pfam | Dirigent-like protein (PF03018.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer