Protein coding transcript 246105

• Transcript: Ll_transcript_121254
• CDS coordinates: 1120-1446 (+)
• Peptide sequence: MREDGKKGVYVENLKEVEVTNARDVIQQLIQGAANRKVAATNMNHASSRSHSVFTCIIESQWESQGVTHFRFARLNLVDLAGSERQKSSGAEGEHLKEVSFNLGACDY*
• ORF Type: complete

Annotations of Ll_transcript_121254

• Blastp: Kinesin-like protein KIN-12E from Arabidopsis with 85% of identity
• Blastx: Kinesin-like protein KIN-12E from Oryza sativa with 74.62% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT3G44050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458049.1)
• Pfam: Kinesin motor domain (PF00225.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;