Transcript | Ll_transcript_121267 |
---|---|
CDS coordinates | 1146-1472 (+) |
Peptide sequence | MREDGKKGVYVENLKEVEVTNARDVIQQLIQGAANRKVAATNMNHASSRSHSVFTCIIESQWESQGVTHFRFARLNLVDLAGSERQKSSGAEGEHLKEVSFNLGACDY* |
ORF Type | complete |
Blastp | Kinesin-like protein KIN-12E from Arabidopsis with 85% of identity |
---|---|
Blastx | Kinesin-like protein KIN-12E from Arabidopsis with 79.86% of identity |
Eggnog | Kinesin family member(COG5059) |
Kegg | Link to kegg annotations (AT3G44050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458049.1) |
Pfam | Kinesin motor domain (PF00225.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer