Transcript | Ll_transcript_119780 |
---|---|
CDS coordinates | 1387-2322 (+) |
Peptide sequence | MDQVDWLPDSIGKLSSLVTLDLSENRIMALPSTIGGLSSLTRLDLHSNGITELPDSIGNLLSLVYLDLQGNQLSSLPASFGRLVRLQELDLSSNQISVLSDTIGSLVGLKVLSVETNDIEEIPHSIGNCSSLRELRADYNRLKALPEAVGKIQSLEILSLRYNNIKQLPTSMSSLINLKELNVSFNELESVPESLCFATSLVKLVIGNNFADMRSLPRSIGNLQMLEELDISNNQIYVLPDSFRMLSRLRVLRVEENPLEVPPRHIAEKGAQAVVQYMAELVEKREKKDVKPQQLKKKKSWTQFLLFSKKA* |
ORF Type | complete |
Blastp | Plant intracellular Ras-group-related LRR protein 4 from Arabidopsis with 74.03% of identity |
---|---|
Blastx | Plant intracellular Ras-group-related LRR protein 4 from Arabidopsis with 72.32% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT4G35470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445149.1) |
Pfam | Leucine rich repeat (PF13855.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer