Protein coding transcript 246152

• Transcript: Ll_transcript_118203
• CDS coordinates: 304-651 (+)
• Peptide sequence: MLVLRSCRENCFNLPFLNDYLKFPSQLWIHVAIAVSRDHKPDQTDERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDRLLKQYVVADPEIQVWVCYHLSEIFDLAVEHSCQPLLI*
• ORF Type: complete

Annotations of Ll_transcript_118203

• Blastp: Probable protein phosphatase 2C 69 from Arabidopsis with 95% of identity
• Blastx: Probable protein phosphatase 2C 59 from Arabidopsis with 98.33% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT5G10740)
• CantataDB: Link to cantataDB annotations (CNT0001502)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017420866.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;