Protein coding transcript 246166

• Transcript: Ll_transcript_118198
• CDS coordinates: 2020-2355 (+)
• Peptide sequence: MWAGTWRVGGVLAVSRAFGDRQLKQYVVADPEIQEEKIDSSLEFLILASDGLWDVVSNEEAVAMVKPIEDAEEAAKILMLEASRRGSADNITCVVVRFSANEAASSHSSSG*
• ORF Type: complete

Annotations of Ll_transcript_118198

• Blastp: Probable protein phosphatase 2C 59 from Arabidopsis with 82.73% of identity
• Blastx: Probable protein phosphatase 2C 59 from Arabidopsis with 89.35% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G31750)
• CantataDB: Link to cantataDB annotations (CNT0001502)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415301.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;