Protein coding transcript 246391

• Transcript: Ll_transcript_119384
• CDS coordinates: 367-1263 (+)
• Peptide sequence: MPEDGVELTPRPQLLTKAEILRVANLFVSGGVNKIRLTGGEPTVRKDIEDICLELSNLKGLRTLSMTTNGIALARKLPKLKECGLTSLNISLDTLIPAKFELMTRRRGHEKVMDSINAAIDLGFNPVKVNCVIMRGFNDDEICDFVELTREKPINIRFIEFMPFDGNVWNVKKLVPYMEMMDTVVKRFPSLKRVQDHSTETAKNFTIDGHQGRVSFITSMTEHFCAGCNRLRLLADGNFKVCLFGPSEVSLRDPLRHGADDQELREIIGAAVKKKKASHAGMFDIAKTANRPMIHIGG*
• ORF Type: complete

Annotations of Ll_transcript_119384

• Blastp: GTP 3',8-cyclase, mitochondrial from Arabidopsis with 83.56% of identity
• Blastx: GTP 3',8-cyclase, mitochondrial from Arabidopsis with 83.88% of identity
• Eggnog: Catalyzes, together with MoaC, the conversion of 5'-GTP to cyclic pyranopterin monophosphate (cPMP or molybdopterin precursor Z) (By similarity)(COG2896)
• Kegg: Link to kegg annotations (AT2G31955)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454459.1)
• Pfam: Radical SAM superfamily (PF04055.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;