Protein coding transcript 2464

• Transcript: Ll_transcript_290426
• CDS coordinates: 82-816 (+)
• Peptide sequence: MSSSKLISTILFSVTLSLILQSSFGADPLFHFCSNSENFTAKSPYETNLKALINSLIYKTPSTGFGIGSVGQYQNQPAYGLALCRGDVSTSECKTCVSEASKEIQNRCEYNKGAIIWYDYCMFKYLDTDFFGKIDNRNKFYMWNLNNVSDPATFNYNTKELLSQLAEKASVNTKLYATGEVKLDESKNLYGLTQCTRELSSIDCKKCLDDAISELPSCCDGKEGGRVVGGSCNFRYEIYPFVKE*
• ORF Type: complete

Annotations of Ll_transcript_290426

• Blastp: Cysteine-rich repeat secretory protein 38 from Arabidopsis with 56.65% of identity
• Blastx: Cysteine-rich repeat secretory protein 38 from Arabidopsis with 56.65% of identity
• Eggnog: cysteine-rich repeat secretory protein(ENOG410YIB0)
• Kegg: Link to kegg annotations (AT3G22060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436194.1)
• Pfam: Salt stress response/antifungal (PF01657.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;