Transcript | Ll_transcript_118245 |
---|---|
CDS coordinates | 890-1594 (+) |
Peptide sequence | MQRLDKKGVSFCTRTTYDDNAITNAVDIYDSFRGGTRFMASNNDCGVREYDMERFQLLNHFHFPWPVNHTSISPDQRLMAVVGDNLDGLLVDPHNGKTVATLIGHRDYSFASAWHPDGHTFATGNQDKTCRVWDARHLSSPVAILKGNLGAARSIRFSSDGQYIVVAEPADFVHVYSIKEDYKKRQEIDFFGEISGVSLSPDDECMYIGIWDRTYASLLQYNRKHAYGYLDSYF* |
ORF Type | complete |
Blastp | Uncharacterized WD repeat-containing protein C2A9.03 from Schizosaccharomyces with 30.88% of identity |
---|---|
Blastx | Uncharacterized WD repeat-containing protein C2A9.03 from Schizosaccharomyces with 30.88% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC2A9.03) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451008.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer